SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD023966 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD023966
Domain Number 1 Region: 365-439
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.02e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 227-287
Classification Level Classification E-value
Superfamily PH domain-like 0.00000642
Family Phosphotyrosine-binding domain (PTB) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD023966
Sequence length 517
Comment 517
Sequence
MQHGDYASSAPPAAGHYYPHQFAPNPPPHPASSAADAAPPTIPASYASAPPYSVGGYSDQ
PPSAPSYAPPPQYAGYAPPYNNPNPAPYPPESSPAPAPYYSYPPTAAGAATQHAPAAEPS
PAPLPYDAPYYGGYQPPPTAGYGDDDYLNEGAYAYSGDGGSEPYGARGTAPTRSGAAMFD
DYGRSIGPSSGGADQWPTGGGGGVGGSFGKIARAVPKAESHEDANGGAQKFRVKLLPEGA
GSPTDVLCQIGLDGIRMLDPSTSRTLRIYPLDTLTRWDVLDSTVFAFWAKTPVDFEAKRI
RLKSNSYTSNTLLDTVTAATVQFKEIGGDARGRGTVDSSKPMSQSNEKKKGFDWMFAKPV
DEVKDHWVPDEAAKKCYSCAVDFSPFNRRHHCRNCGEIFCDKCSQGRTALTAEDNAPLVR
VCDRCMAEVSQRLSIAQEAANRSATVQSHEDLARKLKEEMERNRKSSGSASGGSYGTRMR
EVACPTCTVHLQVQVPTSGSETVECGVCQHAFRVSAN
Download sequence
Identical sequences A2YMW0
39946.BGIOSIBCE025332 OsIBCD023966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]