SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024191 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024191
Domain Number 1 Region: 246-338
Classification Level Classification E-value
Superfamily eEF-1beta-like 6.8e-31
Family eEF-1beta-like 0.0000342
Further Details:      
 
Domain Number 2 Region: 124-175
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000681
Family Glutathione S-transferase (GST), C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024191
Sequence length 360
Comment 360
Sequence
MTGVRPVTDWSFLTIARQFSTPHVCPTALNATWGSWGAVRIKGSSAWGPSSLATPAKRRL
GEGLGAKQCKGPRGITWHPEAPTPRPLLRFVECGDRTMLSLSVFFLEGEMAVSFTNVSSE
AGHKKLDEYLLTRSYISGYQASNDDLAVYSAFSTAPSSSYTNVARWFTHIDALLRLSGVT
ADGQGVKVESTAVPSASTPDVADAKAPAADDDDDDDVDLFGEETEEEKKAAEERAAAVKA
SGKKKESGKSSVLLDVKPWDDETDMTKLEEAVRNVKMEGLLWGASKLVPVGYGIKKLQIM
MTIVDDLVSVDSLIEDYFYTEPANEYIQSCDIVAFNKICKLFHKYQSPSFYLLALFLLLY
Download sequence
Identical sequences OsIBCD024191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]