SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024325 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024325
Domain Number 1 Region: 4-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.18e-62
Family Glutathione peroxidase-like 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024325
Sequence length 220
Comment 220
Sequence
MPGLTLGDVVPDLELDTTHGKIRLHDFVGDAYAIIFSHPADFTPVCTTELSEMAGYAGEF
DKRGVKLLGFSCDDVESHKDWIKDIEAYKPGRRVGFPIVADPDREAIRQLNMIDADEKDT
AGGELPNRALHIVGPDKKVKLSFLFPACTGRNMAEVLRATDALLTAARHRVATPVNWKPG
ERVVIPPGVSDEEAKARFPAGFETAQLPSNKCYLRFTQVD
Download sequence
Identical sequences A0A0E0I4M6 P0C5D0
39946.BGIOSIBCE025758 ONIVA07G23420.1 OsIBCD024325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]