SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024475 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024475
Domain Number 1 Region: 60-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-21
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024475
Sequence length 221
Comment 221
Sequence
MEDGCSKVVSGGGSGSCGGGAKKPFHFARSLTYHHHQGHRVLPPAAKWRRHQLADEPRAR
PKDVVLYTTSLRGVRRTFADCSSVRAILRGFRVAVDERDVSMDAAFRRELRSLLDARGRA
FSLPQLLVGGRLVGGADEVKQLHESGQLRRLLDGAAGQDPAYVCDGCGGVRFVPCTACGG
GRKVFVEEEDRVQRCGDCNENGLCTVFEFGFEPVDPTPIPT
Download sequence
Identical sequences 39946.BGIOSIBCE025912 OsIBCD024475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]