SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024495 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024495
Domain Number 1 Region: 132-224
Classification Level Classification E-value
Superfamily eEF-1beta-like 2.22e-31
Family eEF-1beta-like 0.000033
Further Details:      
 
Domain Number 2 Region: 11-65
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000327
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024495
Sequence length 224
Comment 224
Sequence
MAVTFTDLHTADGLKALEQHLSGKTYVSGNAISKDDIKVFAAVPSKPGAEFPNAARWYDT
VAAALASRFPGKAVGVNLPGGGAASSAAAAAPAAKDADEDDDDLDLFGDETEEDKKAADE
RAASKASSKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLTWGASKLVPVGYGI
KKLQIMLTIVDDLVSVDSLIEEHLTEEPINEFVQSCDIVAFNKI
Download sequence
Identical sequences A0A0D3GUM1 A0A0E0ANW2 A0A0E0I5A4 A2YPM1 I1QCX5 P29545
LOC_Os07g46750.1|13107.m04946|protein OBART07G25380.1 ORGLA07G0196700.1 OGLUM07G25350.1 ONIVA07G25010.1 XP_015646711.1.37577 OsIBCD024495 LOC_Os07g46750.1|PACid:21900937 39946.BGIOSIBCE025932 39947.LOC_Os07g46750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]