SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024788 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024788
Domain Number 1 Region: 473-659
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.75e-19
Family Bacterial glucoamylase C-terminal domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024788
Sequence length 677
Comment 677
Sequence
MGSSELEETKAVLHMDCEKPPAISWERTFDDEGKKVAMFSMTLNDMMAIVPLMIKMLGLN
LKDNAKGLASVYDPLKKWMDNCYRGVPLGGIGGIDKAGIGSWDWKLKEKNCTYHGLFPRS
WTVYNGEPDPEIKITCRQISPFIPHNYKESSFPVAVFTFTLHNSGSTPADVTLLFTWANS
VGGKSELTGNHKNSRMTARDGVHGVLLHHRTADGRPPVTFAIASRETDGVRVTGCPRFTM
GPSNSGDVTAKDMLTNTACSRRTECFVLRGRQCGVGGDGSVEARVVHRSAGGGDDDGGGG
GARAVSFALSWSCPEVKFPAGRTYHRRYTKFHGTDRDAAAERLAHDALLEHMKWESQIEE
WQRPILQDKSLPEWYPITLFNELYYLNAGGTIWTDGQPPKNTSLSSATEPFNLDTFSTVA
NGGSAVDGILSTVAAAAARSNTAAAAAAAMGTALLRDGEENVGQVLYLEGMEYNMWNTYD
VHFYASFALLSLFPELELNLQRDFVRGVLLHDPCLRRTLDGATVARKVLGAVPHDMGLND
PWFEVNAYMLHDPVRWKDLNPKFVLQVYRDVVATGNAGFAEAAWPAVYLAMAYMDQFDRD
GDGMVENEGRPDQTYDLWSVSGVSAYTGGLWVAALQAAAAMAGIVGDGAAEAYFRGRSRI
RRYSPVQTGNESCTKWQ
Download sequence
Identical sequences OsIBCD024788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]