SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD025024 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD025024
Domain Number 1 Region: 352-723
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.84e-115
Family Oxysterol-binding protein 0.0021
Further Details:      
 
Domain Number 2 Region: 43-84,118-183
Classification Level Classification E-value
Superfamily PH domain-like 3.43e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD025024
Sequence length 728
Comment 728
Sequence
MTQSGGGGGGVHHHLNHHGLCCLSAAALPAPDAPPTPEPEAGGAAVAVAGVLHKWTNYGR
GWRERWFSLHDGVLSYSKIRRDASAAADEDGGGGGGGEVRLIGGASARIGGARRPDKPVG
VVCLKLSAFRESKSDDRRFYIFSPTKTLHLKTDSKEDRVAWIEALILARSFYSLRSLSGR
ITFVQSDVSVSTARLRNRMQQEGLNESLIQECEQIVLTEFSSFRKQLKLCYEDQLSLFGS
CRHHFEEGKDASIIQGALTRNDFSSSRHGNFSEYSTTESDEFEKQDGGDLTCEDESTFFD
AADYFIEPNDRSSAMLSSTSCGEGLLDIQMEDSSHLLPQIKRRSKLPEPTEKERGISLWS
IIKDSVGKDLTRVCLPVYFNEPLSSLQKGFEDLEYSHLLDQAYQYGKMGNSLMRILKVAA
FAVSGYASSVARPCKPFNPLLGETYEADFPERGVRFFAEKVSHHPMLIACHCEGKGWKFW
GDSNLKSKFWGQSIQVDPIGVLTVEFDDGEIFQWSKVTTTIHNLILGKLYCSHHGTMHIK
GNRQYSCKLKFKEPSLLDRNPHLVQGFVEDDDGNKPSFLIGKWDENMYYSNLDTSKVKSV
DQLKGAVLLWEKNKPSPNPTRYNLSSFAITLNELSPDLQDKLPPTDSRLRPDQRHLENGE
YEKANAEKLRLERRQRMSSKLQDNGWKPRWFQKDGEDGTYRFKGGYWEAREHGQWDDCLD
IFGEFSET
Download sequence
Identical sequences A2YRC0 Q6ZJR8
39946.BGIOSIBCE026530 OsIBCD025024 XP_015648355.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]