SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD025621 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD025621
Domain Number 1 Region: 79-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.73e-20
Family Thioltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD025621
Sequence length 190
Comment 190
Sequence
MPDIARLNPTHYELAGKTPRLYPCLAAAGNQHTDISHENKCSFLFSPSSYHKSSLPVPYV
SQHACVSLQRVLHGCAYQMVMDKHLSILAKQHVETRFVKVHAEKAPFLTEKLRIVVLPTL
ALVKNTKVEDYVVGFDELGGKDDFSTEDLEERLAKAQVIFLDGEGPAHASKQATKRSVRQ
SDTGNSSDSE
Download sequence
Identical sequences A2YT09
39946.BGIOSIBCE027110 OsIBCD025621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]