SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD025941 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD025941
Domain Number 1 Region: 680-995
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.89e-116
Family Reverse transcriptase 0.00027
Further Details:      
 
Domain Number 2 Region: 504-603
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000826
Family Retroviral protease (retropepsin) 0.047
Further Details:      
 
Weak hits

Sequence:  OsIBCD025941
Domain Number - Region: 258-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0108
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD025941
Sequence length 1177
Comment 1177
Sequence
MHARAAAGGDVTADVIVVVSRDSDVSGVSVFTGEEFEEFQEIPGVTEVREIKNLLLEICK
KKGVEEESAAVSTAAATATIGQHGPDLAGPSHQVRTDVGTTGGLFSVETNTINPTGPGNQ
GNVFGEKVVNTNQISGQLLTTTQTFTRPFPTVLPQSNAMFSTPFSQTFQTAPFLDGFRET
FPNNSPHRNANGSNVNRPFGFAGIHMVDNQRNGFVGGNHYAEAVIKGPRLEISLFEGDDP
IEWLKQCEKFYEIFGTPGDQWVNLAVAHLQGRAAKWFRGVGIPWQLITWPQWCAMVCTRF
SVANVHEAAELFQNVKQYGLSVDQYIDKFEEYVELVRRDHPYLQEQYLTSCFIGGLRGDI
KHDVCGQKPQGLLETYWYAKNYEKAAHARRGVGIAARNRNFNNNATNQGRNQVNRGAQAR
VNGEKKDEKKCWFYKEPWFPRHQCKVKQALHALIMEGDEMEEDEGEETEGEAQEEEELKQ
QEKLQQGEPGKLMCISLNAVQGVIPTDTFAVILRINGKKAMGLVDSGSTSTFMNYNFAIK
NRLPLENTKAQRVVVAGGGELKTDLRVPEIRYEIQGEGFCNAFNLIPLKGYDVVLGADWM
FKVSPITLDLKRRVLGITKLGKLVELLDYTKPGRNYLVSEKKVRKMLRKGGMGYLFQVQK
VSEEEVVDEQLHIPTDIQEVLAQYPEVLKETRGLPPRRDCDHVINLKAGAEPPNLRPYKV
PHYQKAAIEEIISDFLQSNEINVSDSPYSSPAVMVRKHDGSWRMCVDYRQLNAQTVKNKF
PMPIKEDLLDELHGAKYFTKLDLRSGYHQIRMAENDIPKMAFHTHLGHYEYNVMPFGLTN
APATLQSLMNQVLNPYLKKFVLVFFDDILIYSKTRGEHIQHLRLVLQLLLKNQLVVRLKK
CAFGLSSVAYLGHIISPEGVSTDPKKVEDIKNRRAPRDITELRAFLGMTGYYRRFKKGYA
DACGIGIGAVLMQSGKPIAFYSKAIGPKAAEYKAGKENLVADALSRSPNFKTEEKVYCVN
MTVVVPSWVQDIKNSYEEDLQAHKILSLIGTDSDPESNYKLEAGILKYKGRIYVGATADI
RGQLINTYHSSAFGGHSGMRATHHRIKQLFFWPRLKKEVEHFIRHCPTCQITKSEHIHIP
GLLNPLEIPDMAWTHITMDFVEGLSRSNGKDNFLGII
Download sequence
Identical sequences OsIBCD025941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]