SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD026043 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD026043
Domain Number - Region: 4-61
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0271
Family ATP-binding domain of peptide synthetases 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD026043
Sequence length 85
Comment 85
Sequence
MESMCSCWLGQSMRQLVGGVPLWVGKNLGCNRLPEIGVMVNDDGNDIVLAINMSPGLPTR
QLQCPRKDSRSSDVSQQRPQSFGVL
Download sequence
Identical sequences OsIBCD026043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]