SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD027234 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD027234
Domain Number 1 Region: 6-227,275-300
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-54
Family BAR domain 0.006
Further Details:      
 
Domain Number 2 Region: 278-422
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-22
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 648-729
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-22
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  OsIBCD027234
Domain Number - Region: 481-548
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0102
Family Pyk2-associated protein beta ARF-GAP domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD027234
Sequence length 742
Comment 742
Sequence
MLFAKLDDSPMLRTQIQSLEESAEILRERCLKFHKGCRKYTEGLGEAYDGDIAFASSLET
FGGGHNDPISVAFGGPVMTKFTIALRELGTYKEVLRSQVEHMLNDRLLNFVDIDLHDVKD
ARKRFDKASLLYDQVRDKYLSLKKGTRADITTAIEDELHNARSSFEQARFNLVTSISHIE
AKKRFEFLEAGYDLLHQMEPYINQVLAYAQQSRERANKEQASLVERMHEYKKQIDREIRL
SNGLTDAHNGDGIQTIARSSHKMIEAVMQSASKGKVQTIRQGYLSKRSSNLRADWKRRFF
VLDSRGMLYYYRKQINRTPGGCSSHPRSIGNPTEHGSGLLSRLFSSHYHGIIHDEKSVAR
HTVNLLTSTIKVDAEQSDLRFCFRIISPTKVYTLQAESAIDQMDWIEKITGVIASLLSSQ
SPEQCFLLSPKSCGHDGSASESSSFTSQDLEPSMECSGGTPEISEWAYIKAFWWSLDETR
PHGNKFVNDVWEEVLPSSKNGESDDKLRAHGLDTAWHFTVSKPKHSDPFSAKEKFIHAKY
ADKEFVRKYSMDEIQLAQQMWDNVTANDKRAVYSLIVQSRANVNLVYGEMSYSSRSTTGR
SSQQEHSSSPSDGSPVFFDCHSHEKVSPREPLSPASTSSRVDDGDERCEGFSLLHLACHV
ADVGMVELLLQYGANVNAIDSRGRTPLHQCILKGRHIHAKLLLSRGANPQVADQDGRTAL
QCAIDGGTSDDEILVLLEDYTR
Download sequence
Identical sequences OsIBCD027234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]