SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD027372 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD027372
Domain Number 1 Region: 208-367,410-516
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.06e-61
Family Myotubularin-like phosphatases 0.00000954
Further Details:      
 
Domain Number 2 Region: 32-154
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-17
Family GRAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD027372
Sequence length 705
Comment 705
Sequence
MDGSGSWDAIDWNQIKEPRPPRSSSRGMEDFLLEDEEVYAQGHGVVLLNTDEAGILSVTN
FRLLFVSQATKGVIELGTIPLTAIEKINDDVKLQPLPRQHDKKQPRELLQVIGKDMRVIV
FDFLPKTKQKNEVFDALRRYSKPTHLWDLYAFSCDPSTVYQKSDPKMRLLKEYHRLFRKW
FPHSGSEFEKDLRNEWWRGLELFWQGHLSHCNTDEKLVSALCTQIIDATGSLRKLYIVDA
RPRANALANGAKGGGSESASNYPRSEVLFLGIQNIHTMRDSLFRLRDYVDTHGSVSSNGT
SSAVSLVGDRVSLCDGWDRTTQLVALACLLLDPYYRTFNGFQALVEKDWLAFGHPFAERM
GVPTITDNNSGSQFELLRQPSLGTLSNSPNRGALGSSVSTSNTTSGQSQTSNNSSPILLQ
MLYSFVRKFLVDFMDCVLSCRFGNFLCNSEREREQSGAVSSCHCMWTYLADLRASGGSFH
KHRNPFYDPLKHNGPLVPPAAALAPTLWPQFYLRWTCPIESQGGDLESQWHAMNKKYTEA
MKAKDTAESRVKDIKTKMESMQLELQREKRASSSALAMAQRAQRESVAIRKAVRSLGCTV
NFGTNESQVEKTEGLTYSFRRDTDFESQHEKSSDFSISITAIEDSLVSETPSNHICESLC
PFRTREGCRWPDAACAQLGSQFVGLKANFDAFDRLSVQDSYFGSE
Download sequence
Identical sequences OsIBCD027372 39946.BGIOSIBCE028837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]