SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD027446 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD027446
Domain Number 1 Region: 60-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.06e-28
Family Thioltransferase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD027446
Sequence length 164
Comment 164
Sequence
MPPRSLTLSRLPVAALGLPFSSCSPPPPRLRFPIAARRARSLATRASSSSPDSSFGSRME
DSVKRTLADNPVVIYSKSWCSYSMEVKALFKRIGVQPHVIELDQLGAQGPQLQKVLERLT
GQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSELDIDVNNS
Download sequence
Identical sequences A0A0E0IGC9 A2YY90
39946.BGIOSIBCE028921 ONIVA09G01170.1 OsIBCD027446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]