SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD028923 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD028923
Domain Number 1 Region: 286-394
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-24
Family UBX domain 0.0055
Further Details:      
 
Domain Number 2 Region: 67-209
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.16e-24
Family UAS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD028923
Sequence length 396
Comment 396
Sequence
MPSPTSSASAAARGSAGAGDTLRNSCHDFARSLARLPASIMDGLSRSMARRSRRPRDTQP
HPPLPPPLLPEELFFAEFERRYGGRHSFFYGCRLAEALGIARREGRLVFVYLHDAGGGGN
PYADQFCTGTLCSDVVVEFLDANFVSWGAVAGRGEGAAMVAALRPGSFPFCAVVSPVSDE
SIVILQQVEGPVSPSELVDILQRTIDEQRASSRQFWPDEQLAAAVRASRADEEERMRSVA
LRLRQEQDAAYLESLRKDQEKERSRKSVQEGSAKPKASNGLRPRYPGQSAREPNKAAQAR
APAQNQNGTVASHRAEANTKIMIRFPNGERRQQAFHHTDTIREIYRYVDSLGIPGIGNYQ
LVRSYPRKTYGRQQLEMSLQDAGFYPSVTLYIEQLQ
Download sequence
Identical sequences A2Z2G0
39946.BGIOSIBCE030356 OsIBCD028923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]