SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029084 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029084
Domain Number 1 Region: 5-241,285-293
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-58
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 457-596
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.03e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00019
Further Details:      
 
Domain Number 3 Region: 685-785
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-23
Family Ankyrin repeat 0.00096
Further Details:      
 
Domain Number 4 Region: 204-382
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000394
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029084
Sequence length 792
Comment 792
Sequence
MFFTRLDDSPMFRKQIQSLEEGSELLRERCLRFHKGCRKYTEGLGEAYDGDIAFASSLEA
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVENMLNDKLLQFVDIDLHDVKD
ARKRFDKASLLYDQARERYLSLKKGTRTDVATAVEDELHSARSSFEQARFNLVTALSNIE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLAYAQQSRERSNYEQAALVER
MQEFKRQIDRESRWSPNGINDSPNGDGIQAIGRSSHKMIEAVMQSASKGKSGYTNQRSSA
PSEHGSGLLSRWFSSHYHGGVHDEKSVARHTVNLLTSTIKADADQSDLRFCFRIISPTKN
YTLQAESAMDQMDWIEKITGVIASLLSSQSPERRLLSSPKGSGHNRTASESSSFSSSTEL
DHSISEDCMLERNSGSGYFDHSGRAIQHHRTSMKPDKPIDLLRKVVGNNICADCGAAEPD
WASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNTFANTIWED
MLPSSSSVDHGDNSRADGLENTSHNLIFSKPKHSDHIAVKEKFIHAKYAERDYVRKLNMD
DSLVAQQMWENVSSNNKKGVYSLIVGSNADVNLTYGQTSFNSALTLGKALLLQEQPTSPS
DGSSRCFDRSSLERISPRDSLSLASTSARIDELDDCVEGLSLLHLACRVADVGMVELLLQ
YGANVNSADSRGRTPLHHSILKGRHMFAKLLLSRGADSQATDRDGRTALQYAIDSGTIDD
EEILVLLEDPSR
Download sequence
Identical sequences B8BDD2
39946.BGIOSIBCE030539 OsIBCD029084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]