SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029140 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029140
Domain Number 1 Region: 329-488
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.000000000773
Family ATP-binding domain of peptide synthetases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029140
Sequence length 515
Comment 515
Sequence
MHHHQQQQFSLSLQVEHPLAPIINLANLQLQWHIGTEQRSLLLLDRPAMEGLIPFVFGVI
KKRRRRRRRPPGRCYERLHSAGGGGGGVYRSQSCRFPVRAPADEEEELELLYYDDGGRRR
ASPAGALSGEMPASAVGCSERGFLSRSLSCQMPSMRVTTDTWPRRAAQEPLLLLLLRSSL
MKSASLQALNPNRAMAAMGRSVRVVLDSSVLLDPSGVTAEEEEVVVALRPGAEALLRRLR
YSNLRVAICHPEGLTTNEEFMKVYYLNSRITTGKLLPWEIGNSSAFVVGYVMKQSREEDF
AKAIFVHSVTDYYIESFCGSELQKQLAEAKLSFPLIVKPQVACGVADAHNMALIFKIEEF
SNLSVPLPAILQEYIDHGSKIFKFYAIGDKIFHAIKNSMPNASHLKSSSGGKPLTFNSLK
TLPVATKEQLLQNEVQDSKLLDINLVEEAAKLLKELLGLTIFGFDVVVQESSGDHVIVDL
NYLPSFKEVPDNVAMPAFWDAIKQSYESRKQMTQT
Download sequence
Identical sequences 39946.BGIOSIBCE030599 OsIBCD029140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]