SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029191 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029191
Domain Number 1 Region: 40-237,284-545
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.52e-137
Family Cellulases catalytic domain 0.0000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029191
Sequence length 553
Comment 553
Sequence
MALLSAPVRRRRSRVRVLLVCCCLLLALAAPSAAAAAAGHDYGDALAKSILFFEGQRSGR
LPAAGQRAAWRGDSAVSDGGAAGVDLEGGYYDAGDNVKFGFPMAFTATMLAWGVVEFGDA
MPPAERAHAADAVRWATDYLLKTISHPGVGDPTKDHGCWERPEDMDTARTVYNISAARPG
SDVAGETAAALAAASMVFRDDDPAYAARLLAGARSAFEFADEHKGAYSDDPELRAGGCPF
YCDFDGYQVVHRANLFMSFGAKATVATWFHGIGICETEAVISPEKQVGRRTDELLWGAAW
LRRASKEGTYLDYIQNNGKTLGAEDSTNEFGWDNKHAGINVLVSKEFIDGEVLSLQSYKE
FADGFICTLIPESSSPHITYTPGGMIYKPGGSNMQHVTSISFLLLTYAKYLSNSSRTVNC
GNVSVGPATLQQLARKQADYILGDNPMKMSYMVGYGDRYPQRIHHRGSSLPSIKSHPQRI
ACNDGTPYYNSSSPNPNPLIGAVVGGPGEDDVYEDDRADFRKSEPTTYINAPLVGVLAYL
VGNPDPGQGHVRH
Download sequence
Identical sequences OsIBCD029191 39946.BGIOSIBCE030664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]