SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029197 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029197
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0000000000499
Family Cellulases catalytic domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029197
Sequence length 72
Comment 72
Sequence
MVFRDDDPAYAARLLAGARSAFEFADEHKGAYSDDPELRAGGCPFYCDFDGYQKQKALHA
VAAMLAAALAIQ
Download sequence
Identical sequences B8BDT8
OsIBCD029197 39946.BGIOSIBCE030670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]