SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029282 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029282
Domain Number 1 Region: 85-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.32e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0012
Further Details:      
 
Weak hits

Sequence:  OsIBCD029282
Domain Number - Region: 24-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000117
Family Glutathione S-transferase (GST), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029282
Sequence length 4258
Comment 4258
Sequence
MAGLGTGAPIVKVYHEKSMILPDVSRVLTCLYEKDVKFEPCTTSYKSLLRLQASTHAPVP
FYDGPTFLEESREICRYIAETYEHHGYPFLLGKDALERASIEQWLHHEEHAFNPPSRALF
CHLAFPLDQEDDLEMQKAKLDEVLEVYEQRLSDSEFLAGNKFTLADLVHLPNSHYIKASG
KFAYLYDSRKNVQRWWNAISTRHSWDQVLSYMTKVEQDNKLEELEKQKQQEWQREYHTAT
GRRTRLYSRKHTRTKSQTILVPPPDTVSASPTAPQGEQPPPADSLSEKASVFSSQSTTHK
SIASPSKKTTSSTPSLGNFPSTADKPPRIHADMSSIRDVSVPPDTTETEHPTRSMLSSSK
EVGTYIEPTPQKPPASLDNFSESDGPISGASHSQISPRTAKEDSDRLHASDLYRSDRKST
GHSYEATYGKSPTRGATDSSPNKLHSTEAHQMLQAEKWHAVQAGLRNLQGDIDNSVPSRQ
VKPSKEVQQYPSQDSEQTMGVSSPHWQHAADARRISEDEASSDRRIKGAHWSKHAADEDA
QAIPFQTARDDSQDTTQRARETDSVTRSTRDQDAHDSRQGIMTYDSAPSRLQPMDASHDA
PLPSKKSTSQTPYTAAHIPTGYQGAQEFIQQGRERPKPRSVVPYDAQGSTEEEKMAESPP
SKAQILGSRGLDVSPPKEVLNEDGYGATGPLQTRYGDDQDDWIQARDSTTPRHMNQDAIE
ETEMADSEPSKARTLDSQQAFPQKQPPAEDLRFAASTSNRRYFDDQDSTKKSKHTASIPR
RMEAQGSLEETKAGESGLPREQPFLQAQAKDARSLTPPSQEGYAGPQAVSKQRGDPGSIS
RRIRAQDARVTFVESKADDSTFTREQPSDAWQATGPLPEHKVYDAQSSTSPFQDATMKSE
DTTPQQRRGQGAKETKLSDSASLQVQPSDYQRSDSHFQNQEEIEDPHGAISPHKRSYTDV
EDMTKHPGDKILGEDAQDVSEETKALDSTIVRGRAHPQDTHQAAIPPRRQAATKDALGVT
PHFPTRYPTAEDTSRQLRRTASTPTEKAVQDGRDAFREWKSVDSTSSREQPSDVQRAEAS
FPKQEEADSHSTTVPFQRRYPDIEDTTKEPIDKPKEMVGEDAQAGFEETKALDAATEPRD
TPRAAITPSKQVIAKDALSVTPLPPTRYPTAEDTSRQPKRTGSTPTEKAVQDGRDAFRES
KSVDSTSSTQQPSGYRRAAASLPKQEAADSRSTPLPFQRRYPDVEHTTKEPRDKPKESVG
EDAQDGFDETKALDSAIIRGRAQPQETPRAAITPSKQEAAKDALSGTPLSPTRYQTAEET
VGEDSQDGFEETKAFDSAIFRGRAQPQDTRRSAITPPKLEEAKDALGATPHPPTRYPTAE
DTSRQPTRTASTPIEKAVPDGRDAFRELKIVDSTSSREQPSDVRRAAASLRKQEAADSHS
TTVPFQRRYPDIEDTTKEPRDKPKEKVSEEAQDGFEETKDLDSSILRGRAQSQGTQRAAI
TPPKLDAAKDAPGATPLPPTRYPTGEDASRQPRRTASTPTEKAVRGGRDDFTESKSVDST
PSREQPSDVRRAAASLPKQEAADSRSTPLPFQRRYPDVEHTTKEPRDKPKESVGEDAQDS
FEETKALDSSMFRGRAQPQDTRPSAITPSKLEDVRDALGATPLPPRRYPTAEDTSRQPTR
TASTPIEKAVPDGRDAIRELKIVDSTSSREQPSDVRRAPASLPKQEAADSYSTTVPFQRS
YPDNEDTKEPRDKPKEKVSGEAQDGFDETKALDSSILRGRAQPQDTQRAAITPPKLDAAK
DAPGATPLPPTRYPTGEDASRQPRRTASTPTEKAVRGGRDDSTESRSVDSTPSREQPSDV
RRAAASLPKQEAADSRSTPLPFQRRYPDTRDTTKESRDKLKEAVGEDGQDGFEETKALDS
AIIGGRAQPQETPRAAVTPSKLEGAKDALGVTPIAPTRYPTAEDTSKQSTRTASTPSEKA
VPYGRDAFIESKSVDSTSSREQPSDVRRAAASLPKQEAADSRSTTMPFQRRYRDIEDTTK
EPREPRDKPKETVGQDVQDTYEERVTTDSVLFTKQPSDMPRAAITPSKKAANDDAPSVSP
PLPTRYPSAEDTSKQSIRPQDSRDVFREQKAVDSTSSPGPSDSLRASASLPNQEVDGTRR
TTVPFQKREPELQNSTKPVNDSISTSWEMTAQDTQDTFEETKVPDSAAFSMPEVDSQRTD
AEAQAEAQDTRDGGSRSRWWHASKTLPDGTPISGDDVTGLSPGDQMPTRMDQDAIPSTQI
ANGITERSIKQTAEPPAPVAPQTIFHQQARPSAPITKEVQASDNQGAISKIQQVSPDNHP
TDYSAVPRVAAQEQVSHAPQTSPGREGITPAQREMDSPISDALPASAKVQEPAPDKSTMP
FVSSVKQGSHVGHDVEPHEGPLPDTYGAVVDKETTKSLSWQDRSLEASPDSTPTHGYVHP
TSRDEPAILPGQGAPQEPTHPDALDSASTRDVTADSLKLPQNANTGIASFISDQDPSHSA
QETVLAAAERTKALPKPIDQQETPDSRKPPTPDTQYASQIIPSQEKVAPDVPSQEKVSQA
ELSLKPHEGSTPHMHGSIVDEKKTRPLASPTKSSNDVLDLTPAGADVHPTSSTEPPRSAL
PVQAQTPSATQTPPPFASHKSVRTEDIRADANGKVKSVKPSASPDAPHATAPGEVALSEQ
KLASAGRDSSRAAQLPSSDEPRNEQIKDSDHTAQPFSSAAPDQAKDLQRTFGQPDISRAP
GTSESPYSDVYDGARKVDPDYQLIDKTIPSQEQVSHPDLASKTNEGPTETPGPAPLMDVY
DSISTQYIQDGDLDKDQDSANFAQKYSSSEPKEEESTVAAPDQTKEIQTTVGQQDILPAV
SKEKDPSSGVQYDSMEVQEVAPKDQHIDGSIPSHEQAPNVEEPMTHITGPTSALDTQHDQ
DSYQYPELPSSAKSRKETDVAEADKTKAKQMTFGQPVPVPSDATRSVTDQGAQQPQRPAK
IESPPFLETIKNYEYTQNVSDETLDKNKSSGKPSADQEVMSPKVVPATFLDPQRVTVPDD
EQKIAKPDLTRSAQPPFSAEPTKRKTVVGASDQAKASETIVDREGMMTAPYREKSLCPDT
QHALRNVLEMSPSDNLTDNPFAGQEHGSFSEGSTTDSRDAITDESATTSTSGSEKVLDAS
ILTATHDDAHPPTVRNLPEHETQAPASTQSASVEASDKAKSTDQEDMKPMASQASILDTQ
RGTNGDKPIARFLHDQGAQSPELTHPQQPPESPPHSASQHDAPTDVLDKTKMTKLTSTNQ
EGMAPTAGSRSTLESQPDGTFAAEVVHDEQKSTLSDQESARATQPLSSVERSKEDTNVSA
ADQPEVPQTIFHQKARSSVPVTREVQFPDSLGAISKIQEVSPDNQSTDYSAVQPVPTKEQ
VLHAPQTSPDQEGITPAQGEKDSPIPDAQLVPHALQDKGSPRSTQPPPPIESSEKESQIA
EDGQTVLLQSSVVQESTPSLAGPRESSSSDSPYPSAENQVSTPKEVEPLPPTTGMMDRVQ
PSSEATPGVVAGISATPGDNQPSPDRESVEVAEEGTDQQKADQASVQSPQDNMGQVKETE
EQDTGTGETYQATVQSPQDIKEQRDETEQQDTRTGEAYQDAPAPDAPQDKGSPRSTQPPP
PVESSQKESKIAEDSQTLLPQASAVQESTPSSAGPREFTPYPSVEDQGSAPKAEEPLPPT
TANQLGSGSPWKFKYQVDLVGMMDRVQPSSEATPGVVAGISATPGDNQPSPARESAEVAK
EGTGQQKADQASVQSPQDNMGQVKETEEQDTGTGETYQASVQSPQDIKEQRDETEQQDTR
TGEAYQDAPAPDAPQDKGSPRSTQPPPPVESSQKESKIAEDSQTLLPQASAVQESTPSSA
GPRESTPYPSVEDQGSAPKAEEPLPPTTANQLGSGSPWKFKYQVDLVGMMDRVQPSSEAT
PGVVAGISATPGDNQPSPARESAEVAKEGTDQQKADQASVQSPQDNMDQVKETEEQDTGT
GETYQASVQSPQDIKEQRDETEQQDTRTGEAYQDAPAPDAPQDKGLPRSTQPPPPIESSQ
KESEIAEDSQTLLPQASAVQESTPSSASPRDSLSLDSSYSLMENRGSVPNVGKPLPPSTD
MMDRVQPSLGPSLEVSSDEKTTVPLDGLANNLSNVSPSVTASQVLGRSENGSGTGALSGE
TVPSNSQENSEGTPSEEISKQQPQTNMSSTKLSKDDNKEADGSANDTKPGDSEDNPSR
Download sequence
Identical sequences OsIBCD029282 39946.BGIOSIBCE030767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]