SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029379 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029379
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.27e-19
Family Thioltransferase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029379
Sequence length 125
Comment 125
Sequence
MARPGAVKNIESWDEFTKHFVKSEYKLVVLVFMAPWSEPWKLMRPAVEKMASGLKSEEAE
VCTISVDRFNTLGRLLRVEALPTFVLVKRHRAVARVVGVNRDDLHSSINKHLAPPSSSPQ
PINIS
Download sequence
Identical sequences A2Z410
OsIBCD029379 39946.BGIOSIBCE030896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]