SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029488 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029488
Domain Number 1 Region: 135-347
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000141
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029488
Sequence length 370
Comment 370
Sequence
MRVHEEASEDKEREVEEAPDLMPLSPPPTAAATAAVVAVAGQRLVVGYALTKKKVKSFLQ
PKLLSLARKKSIHFVSIDETRPLSEQGPFDIILHKLTDKEWQQVLEVVLEHQSKNFDSIK
ERDYREEHPEVTVLDPPNAIQHLHNRQSMLQEVADLNLSNAYGEVCTPRQLVIMKDPLSI
PSAVAKAGLTLPLVAKPLVVDGTSKSHELSLAYVETSLSMLDPPLVLQEFVNHGGILFKV
YVVGETIRVVRRFSLPDVNIYDLENNDGIFRFPRVSCATNTAEDAEVDPSIAELPPKPLL
EKLGRELRRRLGLRLFNFDMIREHGRKDRYYVIDINYFPGYGKMPGYEHIFIDFLLSLVQ
NKYKRRLSGS
Download sequence
Identical sequences 39946.BGIOSIBCE031017 OsIBCD029488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]