SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030187 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030187
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000753
Family Thioltransferase 0.012
Further Details:      
 
Weak hits

Sequence:  OsIBCD030187
Domain Number - Region: 56-79
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00222
Family DnaJ/Hsp40 cysteine-rich domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030187
Sequence length 106
Comment 106
Sequence
MDPRYLQELGALLPRARGVTLPQVFVGGRHLGGAEEVRRLHESGELRRVVAGAGATALAA
CSQCGGERYVLCGSCNGSHKRYSLKEATTSTIGREDTKSESQRTAI
Download sequence
Identical sequences A2Z672
OsIBCD030187 39946.BGIOSIBCE031661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]