SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030263 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030263
Domain Number 1 Region: 1723-2077
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.99e-98
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000548
Further Details:      
 
Domain Number 2 Region: 1407-1719
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.15e-65
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000116
Further Details:      
 
Domain Number 3 Region: 163-399
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.95e-61
Family BC ATP-binding domain-like 0.000000423
Further Details:      
 
Domain Number 4 Region: 19-161
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.07e-49
Family BC N-terminal domain-like 0.00000275
Further Details:      
 
Domain Number 5 Region: 428-529
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 9.94e-22
Family BC C-terminal domain-like 0.0000262
Further Details:      
 
Domain Number 6 Region: 657-731
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000209
Family Biotinyl/lipoyl-carrier proteins and domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030263
Sequence length 2115
Comment 2115
Sequence
MEGSYQMNGILNGMSNSRHPSSPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRT
WALETFGTEKAILLVAMATPEDLKINAEHIRIADQFVEVPGGTNNNNYANVQLIVEIAER
THVSAVWPGWGHASENPELPDALKEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLP
WSGSHVKIPPESCNSIPEEMYRSACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVH
NDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQ
KIIEEGPITVAPSETVKELEQAARRLAKCVHYVGAATVEYLYSMETGEYYFLELNPRLQV
EHPVTEWIAEINLPAAQVVVGMGVPLYNIPEIRRFYGMEHGGGYDAWRKISAVATKFDLD
NAQSVKPKGHCVAVRVTSEDPDDGFKPTSGRVEELNFKSKPNVWAYFSVKARHVFAFGES
RSLAIANMVLGLKEIQIRGEIRTNVDYTVDLLNAAEYRENKIHTGWLDSRIAMRVRAERP
PWYLSVVGGALYEASSRSSSVVTDYVGYLSKGQIPPKIETVRRGPRSYTLRMNGSEIEAE
IHSLRDGGLLMQLDGNSHVIYAETEAAGTRLLINGRTCLLQGCAKVILQDLKKYVTKEHD
PSKLLADTPCKLLRFLVADGSHVDADTPYAEVEVMKMCMPLLLPASGVIHFVMPEGQAMQ
AADLIARLDLDDPSSVRRAEPFHGTFPKLGPPTAVSGKVHQKFAASVNSAHMILAGYEHN
INEVVQDLLNCLDSPELPFLQWQELMSVLATRLPKDLRNELDGKYKEYELNSDFRKNKDF
PAKLLRGIIEANLAYCSEKDRVTNERLVEPLMSLVKSYEGGRESHARVVVKSLFEEYLSV
EELFSDNIQSDVIERLRLQHAKDLEKVVYIVFSHQLALKASQLLEHTKLSELRTSIARSL
SELEMFTEEGERVSTPRRKMAINERMEDLVGAPLAVEDALVALFDHSDPTLQRRVVETYI
RRLYQPYLVKGSVRMQWHRSGLIALWEFSEEHIKQRNGQDAMSLKQQVEDPEEKRWGVMV
VIKSLQYLSSAIDAALKETSHYKAGAGNVSNGNSASSSHGNMLHIALVGINNQMSTLQDS
GDEDQAQERINKISKILKDSTVTSHLNGAGVRVVSCIIQRDEGRPPMRHSFQWSVDKIYY
EEDPMLRHVEPPLSTFLELNKVNLDGYNEVKYTPSRDRQWHIYTLIKNKKDQRSNDQRLF
LRTIVRQPGVTNGFLSGNVDNEVGRAQASSSYTSSSILRSLMAALEEIELHAHNETVRSS
YSHMYLCILRVQQLFDLIPFSRTIDNVGQDEATACTLLKNMGLNIYEHVGIYREVEDSNT
HKLFYHSVTPSLGPLHGIALDEPYKPLDAIDLKRYSARKNETTYCYDFPLAFETALKRSW
KSTLSVVAEANEHNKSYAKVTELMFADSTGSWGTPLVPVERSPGINDIGIVAWIMKLSTP
EFSGREIIVVSNDVTFKAGSFGPREDAFFDAVTNLACERKLPLIYLSATAGARLGVAEEI
KACFNVGWSDDESPERGFHYIYLTEQDYSRLSSSVIAHELKLESGETRWVVDTIVGKEDG
LGCENLHGSGAIASAYSKAYKETFTLTFVTGRAVGIGAYLARLGMRCIQRLDQPIILTGF
SALNKLLGREVYSSHMQLGGPKIMATNGVVHLTVSDDLEVEGKWMGGMFDRESFVETLEG
WAKTVVTGRAKLGGIPVGVIAVETQTMMQVIPADPGQLDSAERVVPQAGQVWFPDSATKT
AQALLDFNREELPLFILANWRGFSGGQRDLFEGILQAGSNIVENLRTYNQPAFVYIPMGG
ELRGGAWVVVDSKINPEHIEMYAERTAKGNVLEPEGLVEIKFRPKELEECMLRLDPELIK
LSTRLREMKKENAGLSEMDTTRRSIIARMKQLMPIYTQVATRFAELHDTSARMAAKGVIG
KVVDWEESRSFFYRRLRRRVTEDALAKEIREAAGEQLSQKSALDYIKKWYLSSNGSDGNS
EKWNNDEAFFAWKDDPTNYENQLEELKAERVSKWLSRLAESPDVKALPNGLSIVLNKMNP
SKREQVIDGLRQLLG
Download sequence
Identical sequences 39946.BGIOSIBCE031734 OsIBCD030263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]