SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030288 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030288
Domain Number 1 Region: 649-803
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.38e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0000109
Further Details:      
 
Domain Number 2 Region: 181-539
Classification Level Classification E-value
Superfamily L domain-like 5.44e-21
Family Internalin LRR domain 0.058
Further Details:      
 
Domain Number 3 Region: 573-670
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 
Weak hits

Sequence:  OsIBCD030288
Domain Number - Region: 5-83
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0186
Family G proteins 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030288
Sequence length 820
Comment 820
Sequence
MERGSEQLRKKCDGLPLALICVGQFLLSEGTVTGPTCSDVCSNLGHHLENKSNSNALARM
QRVLTRSYTCLSGDAAKACLLYLGMFPGNHSIRRKRLLRRWLAEGLFKRQPHPRLGDSAV
ESFKMLMDQNIVQPVDVSNNEGVKTCQLPGMMLEFIMHRSISEGFITIFRGEDEMLLLPD
QYAVRCLSVQCRSTAAANIGLERNDLSLLRSLTVSGEVCQDFLDFKEYKLLQVLDLEECD
GLMDGHLDGICKLLLLKYLSIGGAVTTLPKMIGRLKFLETFDVRRTKVEVVIMPAEVLVL
PKLVHLFGKFELSGSVSNKIQQIIKSGKSNLQIMSGFVAGSNHGFVQLMCHMKNLRKVKI
WCKSATKRNKSISLSSAIQKFIENGNDPNNARSLSVDFSECSEDILQISPRGDCNLRSLK
LYGELQKIPKFFASLLALRELYLSSTTIRGDVLTALSELRYLVYLKLIAENLEDFMIKYG
AFQSLQRLCFVIQRLTLPGIQEGALPQLVSLQLIYENLANVCLINIGGIKRLKEVMLDSK
MNVESKEYWEGAAKKHPNRPKDELAEIAGWDELKLLGTWPSPFVTRVELALALKGLSQDL
VGMSDLLLASNPVHKKVPVLIHNGKPICESRIILEYIIDEVFPVDGAALLPADPYDWAVA
RFWAAYIDDKAMCPFAITHAMADNVHAVHFVAPWAPMFKGKTEEEKAEGIKQILAAVETL
EGALKGCSKEKPFFGGGTVGLVDIMLGAHIPGVRATEVLTGAKIFNAAITPLLASWTERF
GELDAPKKVLPDVDGMVEYVKRRQAQWAAAGAAAAAASKS
Download sequence
Identical sequences OsIBCD030288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]