SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030296 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030296
Domain Number 1 Region: 206-517
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.68e-88
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000566
Further Details:      
 
Domain Number 2 Region: 512-708
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.1e-44
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.002
Further Details:      
 
Domain Number 3 Region: 52-153
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030296
Sequence length 713
Comment 713
Sequence
MEAKLSFSQDSPPISIISAAKVAGVSLSIDPSLAAGSAPVLCFSSGESLRGINPILEYIA
QSSPSLHGRDAVESGHVVEWLEYAPTFLLGSEFEVACSFVDGYLMSRTFLVGHVLTIADI
TVWSNLAGIGQRWESLRKSKKYQNLVRWFNGIDSDYKDTLNEVIAAYVGKRGIGKSPAPN
LKEKVNDSKDPSAPEVDLPGAKFGEVCVRFAPEPSGYLHIGHAKAALLNKYFAERYQGRL
IVRFDDTNPSKESNEFVENLLKDIETLGIKYDAVTYTSDYFPKLMEMAEKLIKQGKAYVD
DTPKEQMRSERMDGVESKCRNNTVEENLSLWKEMINGSERGMQCCVRGKLDMQDPNKSLR
DPVYYRCNTDPHHRIGSKYKVYPTYDFACPFVDALEGVTHALRSSEYHDRNAQYYRILQD
MGMRRVEIYEFSRLNMVYTLLSKRKLLWFVQNKKVEDWTDPRFPTVQGIVRRGLKVEALI
QFILQQGASKNLNLMEWDKLWTINKKIIDPVCARHTAVLKDQRVIFRLTNGPEKSFVRIL
PRHKKFDGAGKKATTFTNRIWLDYADASAISKGEEVTLMDWGNAIIKEIKMENGVITELI
GELHLEGSVKTTKLKVTWLPDIDDLVPLSLVEFDYLISKKKLEEDENFLDNLNPCTRKET
LALGDANMRNLLRGEVIQLERKGYYRCDAPFVRSSKPVVLFAIPDGRQQASLN
Download sequence
Identical sequences A2Z6H7
39946.BGIOSIBCE031761 OsIBCD030296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]