SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030814 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030814
Domain Number 1 Region: 194-303
Classification Level Classification E-value
Superfamily Bet v1-like 1.32e-28
Family STAR domain 0.011
Further Details:      
 
Domain Number 2 Region: 4-119
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000129
Family Phosphotyrosine-binding domain (PTB) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030814
Sequence length 634
Comment 634
Sequence
MSSSSSSVVYDGWMVRYGRRKIGRSFIHMRYFVLETRLLSYYKRKPQHKMPKLPIKSLHI
DGNCRVEDRGLKMHHGHMLYVLCVYNKREKHQRITMAAFNIQEALIWKEKIEMVIDQQQG
VVASDGNLAHSSSQQKVSLENGRKSSFSDHESLYSHEEEEEEEDNQRSLMRRTTIGNGLR
IFEELQDVDYLARSCSRAMKAVGVVEASCEAIFQLVMSMDTTRYEWDCSFQYGSLVEEVD
GHTAILYHRLQLDWFSMFVWPRDLCYVRYWRRNDDGSYVVLFQSREHPNCGPQPGFVRAQ
IERLREWFSQSDENLILPRIPVMANMAPPVSSKKGRTTQDNTMQTGLQMDQSRQSTMLDE
ESDEDEDQIPESEQETSTHGHDAPVKLSVLDEEDSDQIDVSGFSGNLRRDDRDNTRDCWR
MSDGNNFRVRSKTFIYDKSKIPAGKPLMKLVAVDWFKDMKRMDHVARRKGCAVQVAAEKG
LFALAVNLQVPGTTNYSMVFYFVTKKLIPNSLLQRFVDGDDEFRNSRFKLIPSVPKGSWI
VRQSVGSTPCLLGKAVDITYIRGPNYLEIDVDIGSSTVANGVLGLVCGVITTLVVDMAFL
VQGNTYEELPERLIGAVRVSHIELKSAIVPVLGD
Download sequence
Identical sequences 39946.BGIOSIBCE032317 OsIBCD030814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]