SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030978 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030978
Domain Number 1 Region: 31-140
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000647
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 172-263
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000000632
Family STAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030978
Sequence length 625
Comment 625
Sequence
MMGGVAAEVVVEDAAAAAVAGTGAGGGEEGRMRMEGWLYLIRSNRLGLQYSRKRYFVLED
AALRCFKAPPPPSSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASN
HYDQLKLGARSSEEAARWISPQEKMSILLLVHIEDGKLLDWTVFSSVHNDPMASDVIAPS
PWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEG
MRKRDLLLRRYWRREDDGTYALREFFRAKNGNCACIEFSSGELTRDMRLQQGENERIKIE
MLSASENNRLEDPTEGSLGGSNRHLSSAGSFIQLNDAADEFFDVPDDSEYDQREAMWPSD
ESTHSVDQRHAKLSTAAVFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYGYTLPKDSNCT
MPSTWAMTDPTTFLIRGESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLAGRPGGLVQ
VPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKK
ACLVGQALEINYFRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEE
LPEFLLGTCRLNYLDASKAVSIDEC
Download sequence
Identical sequences 39946.BGIOSIBCE032487 OsIBCD030978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]