SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031017 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031017
Domain Number 1 Region: 172-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-34
Family spliceosomal protein U5-15Kd 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031017
Sequence length 310
Comment 310
Sequence
MSPSRIFAGPPTARGVADGSSTTARAHGVDDGEGRAPRGVASLSLSRSLLSLPLSLPSRV
AARSSPSRIFKLLCKRVHDYNSDDSNDEKRLLAEEEEEEEEEEGASSSGDDEAVGAGAVV
ASEREEKRRREKREKGERGRRKDDMWAPYRVAEAEEEAAACGGGGEAEMSYLLPHLHSGW
AVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYLVDITEVPDFNTM
YELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIA
PKDYSTKYRY
Download sequence
Identical sequences OsIBCD031017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]