SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031112 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031112
Domain Number 1 Region: 151-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.59e-33
Family Thioltransferase 0.0002
Further Details:      
 
Domain Number 2 Region: 392-490
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.1e-31
Family Thioltransferase 0.00016
Further Details:      
 
Domain Number 3 Region: 287-387
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.16e-28
Family Thioltransferase 0.00021
Further Details:      
 
Domain Number 4 Region: 3-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.9e-21
Family Thioltransferase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031112
Sequence length 491
Comment 491
Sequence
MAPVREVGSKAELEAAAGGARAAAVHFWAAWCEASKQMDEVFAHLAVDFPHAVFLRVEAE
EQPEISEAYGVTAVPYFVFLKEGKTVDTLEGANPASLANKVAKLAGPASVAESAVPASLG
VAAGPAVLEKVQEMAQQNGASSTSSAEDALNKRLEQLVNSHPVFLFMKGTPEQPRCGFSR
KVVDVLKQEGVEFGSFDILTDNDVREGMKKFSNWPTFPQLYCKGELLGGCDIVIAMHESG
ELKDVFKEHNIPLQPQGSKNEEAVKAKPDTEKSGAVSEPALLTAAQKERLESLVNSSTVM
AIIKGTPEEPKCGFSGKLVHILKQEKIPFSSFDILTDDEVRQGLKLLSNWPSYPQLYING
ELVGGSDIVMEMHKSGELKKVLSEKGIVAKESLEDRLKALISSAPVMLFMKGTPDAPRCG
FSSKVVNALKQAGVSFGAFDILSDEEVRQGLKTYSNWPTFPQLYYKSELIGGCDIVLELE
KSGELKSTLSE
Download sequence
Identical sequences A2Z916
OsIBCD031112 39946.BGIOSIBCE032645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]