SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031210 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031210
Domain Number 1 Region: 90-207
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000133
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Domain Number 2 Region: 165-293
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000146
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  OsIBCD031210
Domain Number - Region: 304-415
Classification Level Classification E-value
Superfamily PH domain-like 0.000226
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031210
Sequence length 431
Comment 431
Sequence
MKEPAQVRTARGGAADGVEVGVEEEEEPPRSATVKQEEANAVLGAEGSRPFAMRELKEDH
EVAAGSGVKAASGERNGVGSADAQGSSYRYISAIERNHDDPDAYYNWALVLQESADNVDP
NSSSSKDALLEEACKKYAEATRLCPTLYDAYYNWAIAIADRAKMRGRTKEAEELWKQAIL
NYEKAVQLNWNSPQALNNWGLGLQELSAIVPAREKQTIIKTAISKFRAAIQLQFDFHRAI
YNLGTVLYGLAEDTMRSGKPGVSASEFYSQSAIYVAAAHALKPNYSVYRSALRLVRSMLP
LPYLKVGYLIAPPENSAIAPHKEWERSQFVLNHEELQQVNASDQPPSQSPGHVDSGRKLF
RIVVADIVSVSACADLTLPPGAGLRIDTIHGPRFLVADNWETIDSWLDAIRLVYTIFARG
RSDVLAGIITG
Download sequence
Identical sequences OsIBCD031210 39946.BGIOSIBCE032773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]