SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031265 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031265
Domain Number 1 Region: 88-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.0000036
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.94e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031265
Sequence length 232
Comment 232
Sequence
MAGGGDELKLLGMWASPFALRAKLALSFKGLSYDYVEEDLKNKSELLLSSNPVHKKVPVL
IHNGKPICESQVIVQYIDEVFPDAGVTLLPADPHDRAVARFWASYIDEKLLGAWIPVFRG
KTEEEKAEGVKQTFAVAETLEGALSECSKGKPFFGGDTVGYVDVVLGGFVAWVHAIEEVF
GLNQFDAAKTPLLAAWLERFDELDAGKEVMPDIGRLVELEKMRQAQAQAAVY
Download sequence
Identical sequences B8BHY6
OsIBCD031265 39946.BGIOSIBCE032828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]