SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031270 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031270
Domain Number 1 Region: 191-223,250-351
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.91e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.00000902
Further Details:      
 
Domain Number 2 Region: 111-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.87e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031270
Sequence length 369
Comment 369
Sequence
MASRRHGHGGCCRNRTPFRLHRAPLPLSLWLTAPAAELLAVATSPAVAAAGFGERWATTT
GRAAVPPDLGEESELRTSKRQGTQQNKSQKLQILETCLEHWIAMAGGGDDLKMLGVYVSP
FPLRVKLALSFKGLSFEYVEEDLHNKSDLLVSSNPVHKRTPVLIHNGKPISESMVIVQYL
DEAFPGAGAALLPSDPLDRAVARFWASYIDDKVIRMITVHQFSHASFSDDFGADRMMQLF
SAWKMVFKGKTEEEKAEGRKQTFAVAETLEGALRECYKGKPFFGGDAVGFVDVALGGFVP
WVHAMEELFGLRQFDAATTPLLAAWLERVGELEAYKAVMPDAGMMIEFKKKQAQEAAAAA
AAAAAAAEA
Download sequence
Identical sequences A2Z9J8
39946.BGIOSIBCE032834 OsIBCD031270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]