SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031271 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031271
Domain Number 1 Region: 88-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.39e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00000606
Further Details:      
 
Domain Number 2 Region: 8-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.4e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031271
Sequence length 236
Comment 236
Sequence
MAGGGDELKLLGMWASPYVLRVKIALSLKGLSYKYVEEDFKNKSELLLSSNPVHKKVPVL
IHNGKPICESQVILQYLDEAFPDAGATLLPADPHERAVARFWAAFCDDTIAKASQQASSG
KTEEEKAEGEKKVVEALEKMEVGLSECSKGKPFFGGDTVGYVDVVLGGFLAWVRAGDAMK
GVKRFDPATTPLLAAWAERFVELDVAKAAMPEVDKLIELAMARMAGAAAAAAAATN
Download sequence
Identical sequences A0A0E0R1N6 A2Z9J9
OsIBCD031271 39946.BGIOSIBCE032835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]