SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031274 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031274
Domain Number 1 Region: 8-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031274
Sequence length 134
Comment 134
Sequence
MAGGDELNLLGTWPSSFVTRVQIAVGLKGLSFEYAEEDLNNKSELLLSSNPVHKKVPVLI
HDGKPISESQIILQYIDEAFNFNGAFLLSADLYERAVARFWAAYIDDKFVASWVPMIMGK
TEEVVTLGHEQDRG
Download sequence
Identical sequences OsIBCD031274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]