SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031277 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031277
Domain Number 1 Region: 91-226
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.25e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.00000738
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.08e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031277
Sequence length 243
Comment 243
Sequence
MAAGGGGGDELKLLGLWASPYVLRAKFALSFKGLSYENVEEDLHNKSELLLSSNPVHKKV
PVLIHNGKPICESQIIVEYVDEAFPDAGESLLPSDPYDRAVARFWAAYINDKFMPAWQKA
SLGLTEEEKAEAVKQMLAAIENLETAFKELSKGKPFFGGDTAGYLDVTLGAVVGWARAGE
VLFGRKLFDATRSPLLAAWMERFVALDAVKAVLPDNAELIEYGKMRMAHYAKLAAALAAA
NKK
Download sequence
Identical sequences A0A0E0HIB8 A0A0E0R1P8 A2Z9K4 Q945W2
OsIBCD031277 39946.BGIOSIBCE032841 39947.LOC_Os10g38580.1 LOC_Os10g38580.1|13110.m03513|protein XP_015614082.1.37577 ONIVA05G27410.1 LOC_Os10g38580.1|PACid:21883206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]