SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031282 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031282
Domain Number 1 Region: 90-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.18e-42
Family Glutathione S-transferase (GST), C-terminal domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 8-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.75e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031282
Sequence length 239
Comment 239
Sequence
MAGSGDELMLLGKWPSPFVTRVELALGLKGLSYEYVKQDLVNKSELLLASNPVHKKIPVL
IHNGKPVCESSIIVQYIDEAFPDAGASAALLPADPYERAVARFWVAYVDDKFVPAWVATF
RGKTEEEKAEGMKQLLAAVETLEGALKDCSKGKPFFGGDTVGIVDVALGGLISWVKATEV
LAGSKIFDEEKAPLLAAWAQRFGELDVAEKVLPDVDGVVEFAKMRLAEAAAAAAAASKN
Download sequence
Identical sequences Q6WSC3
OsIBCD031282 39946.BGIOSIBCE032847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]