SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031283 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031283
Domain Number 1 Region: 88-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.49e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000442
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.14e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031283
Sequence length 233
Comment 233
Sequence
MAGGGDELKLLGMWASPFALRAKLALSFKGLSYEYVEEDLKNKSELLLSSNPVHKKVPVL
IHNGKPVCESQVIVQYIDEAFPDAGVPLLPSDPYDRAVARFWAAYIDDKLLKSWLQASMC
KTEQEKAAAMKETFAAVANLEAAFKECSKGKPFFGGDAVGYVDVTLGAVIGFVRVGEALH
GMRLFDASRSPLLDAWLDRFAALDAAKAVLPDTGRLAEYAKMKQAEWAAAATN
Download sequence
Identical sequences Q6WSC2
39946.BGIOSIBCE032848 OsIBCD031283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]