SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031286 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031286
Domain Number 1 Region: 52-167
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.24e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000087
Family Glutathione S-transferase (GST), N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031286
Sequence length 183
Comment 183
Sequence
MAGHDELKLLGTWASPYVSRVKLALHLKGLSYEYVVEEDHFNNKSELLLSSNQLVPSWKQ
AFSGKTGEEKAEGMRHMLAAVDALEAAMEEWSKGKPFFGGDAVGFLDVALGGLLSWLHGT
EELCGAKILDAAKTPLLSAWARRFGEMDAAKVALPDVCKLVEFAKMRRVQLEAAMAATTV
SRN
Download sequence
Identical sequences A2Z9L4
OsIBCD031286 39946.BGIOSIBCE032851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]