SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031292 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031292
Domain Number 1 Region: 90-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00000261
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031292
Sequence length 235
Comment 235
Sequence
MAGGGDELKLLGTWFSPFVSRVKFVFHLKGLSYENIEEDLKNKSELLLKSNPAIKKVPVL
FHNGKPLCESMIIVEYIDETFAGVGPSVVPTDAYERAVARFWVSYIDNKLVAPWFQVFRS
KSMEEKAEGLKQIFVAVMVLEEAFKECSKGRPFFGGDNAGIVDIALGSQLGWVRASQALS
GIKLFDPAKTPLLAAWAERFLALDAAKASMPEFGRLIEYAKMRQAESDAANAAAN
Download sequence
Identical sequences A0A0E0HID0 A0A0E0R1Q2 A2Z9M3 Q8S715
39946.BGIOSIBCE032860 39947.LOC_Os10g38670.1 LOC_Os10g38670.1|PACid:21883060 LOC_Os10g38670.1|13110.m03522|protein ONIVA05G27530.1 XP_015614529.1.37577 OsIBCD031292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]