SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031418 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031418
Domain Number 1 Region: 356-733
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.75e-114
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 48-86,116-172
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031418
Sequence length 742
Comment 742
Sequence
MRAREMHPLCCLVADCALGGGGGGGGGEGGGGDCSPTKAAVGGEEEVVAVAGVLYKWTNI
GKGWRPRWFAIRGGVLAYSKIRRRVAAEPPPEAAAAAAANGVRLIGVPRGGVGDQPIGFV
PLKISSFSESKSDDKRFYIITPTKTLQLRTGSAKDRVAWIEALVSARSEYSLNGGVPCDQ
NEGSFSTEKLRNRLHAEGVGEATIKDCEQIIHSEFSQYHTQMKQRCEDYLNFIGSLPREL
EVVNSGDASAIEKPQSELFKHDCSSSGKCSEYSNTESSDDAGKQEVGQLSDEDEFHFYDT
RQSFSDTAASPDLKMRCSNSGSGAHKFGELLAIDKTNEYLLSSSKRRSELPVPIEKEKGV
SLWSMIKDNVGKDLTRVCLPVYFNEPLSSLQKCFEDLEYSNLLDRAYDYGSRGNGLMRIL
YVAAFAVSGYASTDSRPCKPFNPLLGETYEADYPEKGIRFFSEKVSHHPMVMACHCEGKG
WKFWGDSNLKSKFWGQSIQLDPSGVLTLQFDDGETFQWSKVTTTINNLIIGRVYCHHHGT
MNISGNRQYSCKLTFKEQSFLDRNPRQVQGLVTDANGTKVAFLMGKWDESMSCIIGDDAS
KVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTPGLKEKLPPTDSRLRPDQ
RHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTEDGTFRYVGGYWEAREQR
KWVGCNDIFGNNVSTLCTSASI
Download sequence
Identical sequences A2ZA34
39946.BGIOSIBCE033018 OsIBCD031418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]