SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD033694 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD033694
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.91e-40
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 257-402
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 3.97e-19
Family Succinyl-CoA synthetase domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD033694
Sequence length 423
Comment 423
Sequence
MARKKIREYDSKRLLKEHLKRLAGIDLQILSAQVTQSTDFTELVNQQPWLSTMKLVVKPD
MLFGKRGKSGLVALNLDIAQVKEFVKERLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLS
IVSERLGSTISFSECGGIEIEENWDKVKTIFLPTEKPMTPDACAPLIATLPLEARGKIGD
FIKGVFAVFQDLDFSFLEMNPFTIVNGEPYPLDMRGELDDTAAFKNFKKWGNIEFPLPFG
RVLSSTEGFIHDLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGN
YAEYSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGIANFTDVGATFSGIIRALRE
KESKLKAARMHIYVRRGGPNYQTGLAKMRKLGAELGVPIEVYGPEATMTGICKQAIECVM
AAA
Download sequence
Identical sequences B8BIJ8 Q2QZ86
OsIBCD033694 LOC_Os11g47330.1|13111.m04692|protein 39946.BGIOSIBCE035340 39947.LOC_Os11g47330.1 LOC_Os11g47330.1|PACid:21946285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]