SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD033920 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD033920
Domain Number - Region: 397-443
Classification Level Classification E-value
Superfamily PH domain-like 0.0102
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD033920
Sequence length 475
Comment 475
Sequence
MPPRARTLLMPLAAATLLVASTIFLFAATGARWRPADTGLPVPAADFSAAVLESAVTDTT
AAAKELSFVDENGRPDDPASSSAAAARCDPTHAAVRVFMYDLPPEFHFGILGWSPPTDGA
ADAAMWPDVGSGAAAPRYPGGLNQQHSVEYWLTLDLLSSSSPPCGAAVRVADSRDADVVF
VPFFASLSYNRHSRVVPPEKVSRDKELQEKLVRYLMAQPEWKRSGGADHVIVAHHPNSLL
HARSVLFPVVFVLSDFGRYHPRVASLEKDVIAPYKHMAKTFVNDSAGFDDRPTLLYFRGA
IFRKEGGNIRQELYYMLKDEKDVYFAFGSVQDHGASKASKGMHASKFCLNIAGDTPSSNR
LFDAIVSHCVPVIISDDIELPYEDALDYSKFSIFVRSSDAVKKGYLMRLIRGVSKHQWTR
MWNRLKEVDKHFEYQYPSQKDDAVQMIWQALARKVPAIRLKSHRSRRFSRYDRGK
Download sequence
Identical sequences B8BLT2 Q2QYC6
LOC_Os12g03100.1|13112.m00265|protein XP_015620647.1.37577 LOC_Os12g03100.1|PACid:21935202 39946.BGIOSIBCE035588 39947.LOC_Os12g03100.1 OsIBCD033920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]