SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034092 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034092
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-47
Family Dcp1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034092
Sequence length 353
Comment 353
Sequence
MDAEGTRLLNLTVLQRLDPAVEDILITAAHVTLYDFNIELNQWSRKDVEGSLFVVKRNKQ
PRFQFIVMNRRNTDNLVEDLLSDFEFELQPPYLLYRNAAQEVNGIWFYNQQDCDAVAGVF
GRILNAYAKVPPKPKVPSTKSEFEELEAVPTSAAIDGPLEPSSSSTVLVSNAPDESLTDY
FSGAVNVGNVSITPMVGRTHQPIESVASSHVPLIIPSAAPTHQMGVPSGAASAPPLPVID
TNVHSSHSTNLVTPAFFAPPSSSSASLVAPASSFMPTASPFHPTSADAHRPAYGHGTPLL
QPLPPPTPPASLTPVHNDEPVISRDKVKDALLRLVQNDEFINLLYQELQNAHA
Download sequence
Identical sequences 39946.BGIOSIBCE035798 OsIBCD034092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]