SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034601 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034601
Domain Number 1 Region: 385-756
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.48e-116
Family Oxysterol-binding protein 0.00049
Further Details:      
 
Domain Number 2 Region: 66-96,132-190
Classification Level Classification E-value
Superfamily PH domain-like 4.85e-20
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034601
Sequence length 873
Comment 873
Sequence
MHAVSAQVHQHQTSAQSEQPTNQAQPAESLAGGRPAGSTTVSNTPPAAAGAAAAAQVVLD
AAQAAVAGVLHKWVNYGKGWRLRWFVLEGGVLSYYKLRVGGGGDSAASRAVAARVIGEGG
ALRRAREEAAAAGKQWKPFGEIHLKVSSIRASKSDDKRLYIFSGTKTLHLRCETEEDRNA
WIQALQAAKDRFPRSLTSNDFSPMSDVLLSTEKLRVRLLQEGLNETVVKECESIMMTELL
ELHNQMKSQQQQYSILIDQLRQLETEKVELERTVVHETKEREAHGYANGRYSDFYSVLSG
GSASESDPDTASQVADVETDEDEVMYFDTRDFLSAESLRSASCRRRELLTNGCNGLEHID
PAANVVKTKYPSVKRRDKLPEPKEKENPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQ
KCFEDLEYSYLVDHALQWGKQGDSLMRTLHVAAFAVSGYASTEGRQCKPFNPLLGETYEA
DYPDKGLRFFSEKVSHHPMVVACHCEGRGWKFWGDSNLKGKFWGRSIQLDPIGVLTLQFD
DGETFQWSKVTTSIYNIIIGKIYCDHYGTMRIKGSGDYSCKLKFKEQSIIDRNPHQVHGF
VQDNRTGQKVAMLIGKWDEAMYYVLGDPSAKPKGYDPMSEAVLLWERDKSLNQTRYNLSP
FAISLNELTPNLAKKLPPTDSRLRPDQRHLENGEYEMANAEKLRLEQLQRQARRLQEKGW
QPRWFSKDDDDSYRYVGGYWEAREKGNWDGIPDIFDQGCPAPAEFHDVRCLIAKPRSLIA
ILAIHIILNSVFFNQHGSVETGEEVQQKSLMRASQVVCLILVVAALFVALASLQASADAS
GLHEEAGAFKKGKLPWWWDTDYTRSKRRRPIHN
Download sequence
Identical sequences 39946.BGIOSIBCE036268 OsIBCD034601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]