SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034746 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034746
Domain Number 1 Region: 19-165
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.06e-31
Family Cellulases catalytic domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034746
Sequence length 197
Comment 197
Sequence
MREGGALLQVESRGRSYRDSGSLLFTVLLSRVSFFASQGSDVAQDDVLGMYKQTADAVMC
ILLPDSETAAFRTKGGLLYVDEWNSLQHPVASAFLAAVYSDYMQSSRKTELSCSGQGFSP
SDLRKFAKSQADYLLGSNPMKISCLVGYGDRYPERVHHRGTSIPEDVDTGATATSAVVKQ
DLEMGVPSLTRHCSVDV
Download sequence
Identical sequences OsIBCD034746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]