SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD035367 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD035367
Domain Number 1 Region: 436-707
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000026
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 2 Region: 335-475
Classification Level Classification E-value
Superfamily TPR-like 0.0000024
Family CT2138-like 0.048
Further Details:      
 
Weak hits

Sequence:  OsIBCD035367
Domain Number - Region: 59-102,205-228
Classification Level Classification E-value
Superfamily TPR-like 0.00128
Family Transcription factor MalT domain III 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD035367
Sequence length 722
Comment 722
Sequence
MAESDNNGSEVSPGGGGRDSASAAAAVASPVKAKARALLELETASAAAAASESSEARVDD
GNIQEAESSLREGLSLNYEEARALLGRLEYQRGNVEAALRVFDGIDLQAAIQRFQPSLSE
KPPSKRSNKLRSDSSNSGSQHAASLVLEAIYLKSMSLQKLGKAVEAAQQCRSVLDAVESI
FQRGIPDVMVEQKLQETVSKSVELLPELWKQAGAYQEALASYRRALLSQWNLDDDCCTRI
QKRFAVFLLYGGVEASPPSLASQTEGSYVPKNNLEEAILLLMIILKKWYLGKTHWDPSVM
EHLTFALSLCGQTSVLAKHLEEVLPGIYPRTGRWYSLALCNYAASHNEAALNLLRKLLNK
NESPGDIMALLLAAKLCSSDYSLASEGVEYARRAVTNVDSSDGHLKSAALHFLGSCLAKK
SRIATSDHQRSLLQTESLKSLSEAISLDRHNPDLIYDMGIEYAEQRNMQAALKCAKEFID
ATGGSVSKGWRLLSLVLSAQQRYSEAEVVTDAALDETTKWEQGPLLRIKAKLKVAQSLPM
EAVEAYRALLALVQAQRKAYGTVKNGTEEVDNKVSEFEVWQGLANLYASLSYWRDAEICL
QKAKALKSFSAITLHAEGYTREVREQTQDALAAYFNAVSTEVEHVPSKVSIGALLSKQGP
KYLPVARSFLSDALRHEPTNRMAWFYLGKVHKHDGRLADAADCFQAASMLEESDPIESFR
SL
Download sequence
Identical sequences OsIBCD035367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]