SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD035373 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD035373
Domain Number 1 Region: 72-281
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.09e-34
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 302-408
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 0.0000000000000916
Family Succinyl-CoA synthetase domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD035373
Sequence length 429
Comment 429
Sequence
MARKKIREYDSKRLLREHLKRLAAIDLHILSAQQSYTSTAAKLFAYLMQPAIIGASFVLW
DLISGMMVTESTDFTELVNQEPWLSSMKLVVKPDMLFGKRGKSGLVALNLDLAQVRQFVK
ERLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGFTISFSECGGIEIEENWDK
VKTVFLPTEKAMTPDACAPLIATLPLEVRTKIGDFIRGVYSVFQGYSVHSIDLLADLDFS
FLEMNPFTMVNGEPYPLDMRGELDDTAAFKNFKKWGNIQFPLPFGRVLSPSESFIHELDE
KTSSSLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAEYSGAPNEEEVLQ
YARVVLDESKLKAARMNIYVRRGGPNYQTGLAKMRTLGAELGVPIEVYGPEATMTGICKQ
AIDCIMAEA
Download sequence
Identical sequences 39946.BGIOSIBCE036989 OsIBCD035373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]