SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD035586 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD035586
Domain Number - Region: 139-246
Classification Level Classification E-value
Superfamily PH domain-like 0.00716
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD035586
Sequence length 261
Comment 261
Sequence
MAVASAATLVAAQCVEAAESLGAERDHLAAAIASAVNVRTPGDIVTITAAAATALRGAAT
LKARALKDVWNVAAVIPVEKNAIAAATTGGGHHKHNAQKQQHHHRHHGNGSNTSSSFSDE
VAAVDDDDDDDNNFLTICSQELLARGTELLKRTRKGALHWKVVSVYIHRTGVVMLKMKSR
HVAGTLTKKKKNVVVDVCRDVAAWPGRHLLEGGEHRRYFGLRTAEHRVIEFECGSQREHD
MWTKGVARLLATIDGRRKRFA
Download sequence
Identical sequences A2ZMG6
39946.BGIOSIBCE037240 OsIBCD035586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]