SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD035599 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD035599
Domain Number 1 Region: 161-337
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-52
Family BC ATP-binding domain-like 0.0000126
Further Details:      
 
Domain Number 2 Region: 34-150
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.37e-49
Family BC N-terminal domain-like 0.0000249
Further Details:      
 
Domain Number 3 Region: 403-519
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.94e-36
Family BC C-terminal domain-like 0.00024
Further Details:      
 
Domain Number 4 Region: 692-768
Classification Level Classification E-value
Superfamily Single hybrid motif 2.22e-18
Family Biotinyl/lipoyl-carrier proteins and domains 0.00096
Further Details:      
 
Domain Number 5 Region: 361-416
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00000707
Family BC ATP-binding domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD035599
Sequence length 774
Comment 774
Sequence
MASRLLLLPRRRSRHGGASLLLARLLSSSSSEAGGGGAVEKVLVANRGEIACRVMRTARR
LGIPTVAVYSDADRGALHVRAADEAVRLGPPPARESYLNASAIVDAALRTGAKAIHPGYG
FLSESADFAQLCKAEGLTFIGPPPSAIRDMGDKSYVKTSASKWIMGAAGVPLVPGYHGAE
QDIELLKLEANKIGYPVLIKPTHGGGGKGMRIVQRPEDFVDSVLSAQREAAASFGINTLL
VEKYITQPRHIEVQIFGDQHGNVIHLYERDCSLQRRHQKIIEEAPAPNVTAQFRSHIGEA
AVSAAKAVGYYSAGTVEFIVDTLSGEFYFMEMNTRLQPVNRIKLQYKLDVVISNIKILYM
VNRYLKVEHPVTEMIVGQDLVEWQIRIANGECLPLSQEQVPLNGHAFEARIYAENVPRGF
LPATGTLHHYRPVPSTATVRVETGVEEGDTVSMHYDPMIAKLVVWGESRNAALVKLKNSL
SNFQIAGLPTNVGFLQELAGHSAFEKGLVDTHFIERYQNDLLSTSTQALSGSHEAEELGA
ILAAACICKKDHVSSEVSLHDKKLSMWYAHPPFRMHHFAKRLMEFELDRELGGSSDDLLK
LSVTYRSDGTYGTYFVETEDGSSPGLDVKVDSRGDHDFRVDVGGLQTDVTLAFYSKDNCN
HIHIWHGKHHHHYRQTLRAEQSPDDSSQPSASSEARSHPKGSVLAPMAGLVVKVLLKDGA
RVEEGQPVMVMEAMKMEHVVKAPCAGYVEGLKATAGQQVFDSSVLFTVKENKPN
Download sequence
Identical sequences OsIBCD035599 39946.BGIOSIBCE037253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]