SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD036086 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD036086
Domain Number 1 Region: 225-326
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000415
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD036086
Sequence length 393
Comment 393
Sequence
MGCAGSKDVTVADVYRPPPTSVSLFDISAIEEPWLIATGKKNDEEEEEEDEEEEEEEEEE
EEGKKPTTTVMPLPLLDKLDGYDLAPASWSEVSKALEDIKPALSSNTTTTENAKKKTKKK
KKKKQPAPPPQPPTTTTTVLPEPVKAIEAAAKKAAAAPSARGANEEVDRRPPPPELTGRR
VVKDNPFLMRDRENKGNDGGAAAAAARWRRRDPFEGYPERRPPGASGGGVVLYTTTLRGV
RRTFEDCERARQAVEACAEAVSAAGGSPVVVDERDVSLHGEYLRELRGLAGAGDAPPRLF
VMGRYLGGADACAELAESGKLREMMRWARARGEACAAKDGRGCEGCGGARFVPCWECGGS
CKVVVAGATAAAADVERCAKCNENGLMLCPICH
Download sequence
Identical sequences A2WMJ3
OsIBCD036086 39946.BGIOSIBCE001020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]